SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000160099|PACid:22658087 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000160099|PACid:22658087
Domain Number 1 Region: 7-240
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0048
Further Details:      
 
Domain Number 2 Region: 268-419
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.06e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000160099|PACid:22658087
Sequence length 464
Sequence
MASETYQPKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHEVGGQWLYDPNVEGEDPLG
RSPTLKVHSSLYSSLRIISPRESMGFTDFPFAVKKGRDMRRFPGHTELLLYLKDFCDWFG
LRELIRFNTRVSYVGMLDGDHVVGCKDLKWVVRSMEKKAEIFVEEVFDAVVVASGHYSNP
RLPSIKGMDAWKRKQMHSHIYRVPEPFRDEARQYIVVVVVANSLSGQDISIDLVAVAKAI
YLSARSLDISKGLSKVISKHENLHLRPQIESLQEDGKVLFVDGSWITADTIIYCTGYSYT
FSFLDTKGIVTVDDNRVGPLYEHTFPPSLAPSLSFVGIPKKVIGFLFFESQAKWIAQLLS
GKTTLPSRDDMMQSIKEFYHSREVAGIPKHDTHGIGDFEYCDRYGDHSGFPHLEEWRKEL
CYSAQIHADADLTFRDSCDDHELLQKAFQSPYFAQFRPQDXDFL
Download sequence
Identical sequences MDP0000160099 MDP0000160099|PACid:22658087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]