SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000160647|PACid:22627261 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000160647|PACid:22627261
Domain Number 1 Region: 194-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000196
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000160647|PACid:22627261
Sequence length 476
Sequence
MENFNPPSIPSTTTITSAHKTNNSQSTCEPVSCLPSTTCSPSATQYRYYPAQYLAPNPGL
QFLHANNQYPYRQAGLHMYPFLVSAQPNMVLSREQASRDQSGWILDALMSKSARNERKMA
RQRSLSLSRNAANAAVSCTCSPPLSRHPPFHGNDGDDDTRGIISTSSSGNGADLQNTKEQ
LYSFCTPDNKKLRPLFKKELKNSDVGPLGRIILPKKEAENNLPMLSDREGIQLTVRDVHS
NRHWEFKYKFWSNNRSRMYVFEYTAAFFVHARKQYISVEKVQRPVHVAEPSSSKQRNTTT
NPTDQTIKIVPNINTSLKANTTDNNKTNTNTNTNAKTPNTDAKTLGSNPYVASNLSSPSP
YTYVAGNKEDELSLEQLVEQLKQDQETNIFADALSMVSRDYREHEEATALSNIAASHIET
STQPPSTLAVGIDPSSSSSSSQTRATMRMVDDDHFDLDDCYKGLGMLPEVNRYKYI
Download sequence
Identical sequences MDP0000160647 MDP0000160647|PACid:22627261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]