SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000162193|PACid:22629958 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000162193|PACid:22629958
Domain Number 1 Region: 828-1171,1274-1318
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.1e-69
Family FAD-linked reductases, N-terminal domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 1153-1264
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.37e-29
Family L-aminoacid/polyamine oxidase 0.00035
Further Details:      
 
Domain Number 3 Region: 570-666
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000108
Family SWIRM domain 0.042
Further Details:      
 
Weak hits

Sequence:  MDP0000162193|PACid:22629958
Domain Number - Region: 1404-1488
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000314
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000162193|PACid:22629958
Sequence length 1983
Sequence
MDGEDKKSGFKKRSKFLEANMVDSDDDEPIGSLLKLKRQRNPKKVKPRSEGGGERGQKIE
DEEEYLGGLDDTLASLRKKLKGPKKDSGTGTMRGRSFDLDGVQSLDRSSNGHVDDGGLDA
KSVSRVLEKGPVMGDDGSDVTIDIGVENKLNGNVRGKRPKISRSMRFGEGSNSSLDHHLR
DSLPAFSRKSQSGLVMNSRASSXPKEKSGSKVLEEGLKPSVDGVAQNTPLSDSNSLDSAS
DHCKADESQSFDYRLCQASNLHRENQETFNDKNHKRPYKIVAEDRAPVYSHSGFDSKLIN
NEAIVAPSGSNFQEGPCSSDEVNDGDSKHLTXQMRTFEDGLKHCSIGGSIQSKDVLGRCT
SAADCETSSPAGKGIMRPHCNDDLLDKSCENTLEDKHLVSSLHLQQNSLTCHVKVEDELD
SDRCPNFSQHTQHQLLNFASNTVGMEDTHSNCNGLITYTKNPGLASGPLQEKNDVPIHDH
LITCEEADENESCPEDTVSLPDVENKSTKLSAIQRVGRNVRKRRHGDMAYEGDADWDVLI
NDQGSDGDNSFRMRVKFDSSSSIGTESESGEAAAVSAGLKANAVGPVEKIKFKEILKRRG
GVQDYLECRNQILALWNKDVSRILPLTDCGVTDTSCADDSPRASLIKDIYAFLDLSGYIN
IGIAREKDKAEPGSKHDYKILREKNFEEISGVSVADSEDGVSFIIGQVKSSKTKIDXKSG
VIIKSNNSTQGVSRDNELVTTVALELSNATNHAECKADHLENTSVDARLQSKLDNMDVSS
SVPIGETLGDGGIPLVTPELKNVSHSTQCASQDHAVRNNNLQCGLEVKKKIIVIGAGPAG
LTAARHLQRQGFSVTILEARSRIGGRVYTDRSSLSVPVDLGASIITGVEADWATERRPDP
SSLVCAQLGLELTVLNSDCPLYDIATGEKVPADLDEALEAEFNSLLDDMVLLVAKEGEQT
RXSLEEGLEYALKRRRMAKTGTSIEAKELNGLMDGFIDAKKSIDRAEESCQKQEXLSPLE
RRVMDWHFANLEYGCATLLKEVSLPNWNQDDVYGGFGGAHCMIKGGYSTVIESLGEGLQI
RLNHVVTDVSYGTKDAGLNTNPGNKVKVSTSNGNDFSGDAVLVTVPLGCLKAETIKFSPP
LPHWKHSSILRLGFGVLNKVVLEFPDVFWDDSVDYFGATAEETDLRGQCFMFWNVKKTVG
APVLIALVVGKAAIDGQKMSPSEHVNHALAVLRKLFGEASVPDPVASVVTDWGRDPFSYG
AYSYVAVGASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMMSGLREAVRIIDILTT
GNDYTAEAEAIAGIQRQSDSERDEVRDMTRRLDAVELSNVLYKNKEALLQDMFFNAKTTK
GRLHLAKELLSLPAETLKSFAGTKEGLTILNLWILDSMGKAGTQLLRHCVRLLVLVSTDL
LAVRLSGIGKTVREKVCVHTSRDIRAIASQLVNVWLEVFRKEKASNGALKLSRQATAADA
WKRKTIRDPSSSKPPLHTFHCGLEHKGSLQDSASTASHLPLNANGKKVNGKSIKGETANS
SKSEINSSRFRGSTGRPHSELKEIDVAVTEAERAAIAAAEAARAAALAAAEAYASSEAKS
STLLQLPKIPSFHKFARREQYPQMDEYDLRRKWSGGVLGRQDCVSEIDSRNCKVRDWSVD
FSAACVNIDSSRMSVDNLSQRSNPNETASQTNFREHSGESAAVDSSIYTRAWVDTAGSAG
IKDYHAIEMWQSQAAAADPDFFHSAPYINDEEDSNTTSRKHSWKNEGPVNESSVSQVTMN
KESLKSHHRGADNIKQAVVDYVASLLMPLYKAKKIDREGYKSIMKKSATKVMELATDSEK
AMAVSEFLDFKRRNKWWLTDRIKSDLLNGTANKHFSDLEGAMVERARLLPVEPGIVKCXY
VWSVQQGQPFWMQMESRIVLVNKNTEHFSMVAKKPLTSYFLSIKLNGVAYFSIGRQRDEI
CAF
Download sequence
Identical sequences MDP0000162193|PACid:22629958 MDP0000162193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]