SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000165104|PACid:22650835 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000165104|PACid:22650835
Domain Number 1 Region: 13-95
Classification Level Classification E-value
Superfamily L domain-like 0.00000129
Family mRNA export factor tap 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000165104|PACid:22650835
Sequence length 105
Sequence
MGYTPTRTAPTLQDPTKSLQNWTKSTFANPCSGLTSYLQGATCNNGRIFKLSLTNLSLHD
SISPFLADCTNLQTYDLSSNFIAGPIPQQLDFFVCLSAFVDLQQR
Download sequence
Identical sequences MDP0000165104|PACid:22650835 MDP0000165104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]