SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000165802|PACid:22635978 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000165802|PACid:22635978
Domain Number 1 Region: 222-317
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-24
Family B3 DNA binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 97-153
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000183
Family GCC-box binding domain 0.00084
Further Details:      
 
Domain Number 3 Region: 472-527,696-720
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000837
Family F-box domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000165802|PACid:22635978
Sequence length 875
Sequence
MXHTLLANCLAMSATPSETKFSGFNSNPGFVVKSGGGKRKQELVLASGGATDLLLPFICS
GLLVEXLXQKRYGRGHVKHGLKQRSEIWWASRXVSKRFKGVVEQPNGHWGAQIYANHERV
WLGTFSSENEAAMAYDSAAIKLRGCDCHRNFPWTKFTFEEPHFQXQYSKEAVLRMIKDGS
YQAEFLEYRRSHAARESLRSDIQFGSLARVHNNGNGKMLNRLLFQKELTPSDVGKLNRLV
IPVSNAKRCFPSISEATSQKVESCSSQLVFYDNMMRSWTFRYCYWKSSRSFVFTKGWSRF
VKTHHLKAKDILTFFQCQYKQLGDNGNKEPQTFYMVKVNWDGVESEDVSCLVENDAKNYQ
YDNCKLEAVSQNMNEAEGILADQKKRFRLFGVEICNEHPDTCPYKIFLSTIGFRECNGTS
GTKQQLGKDPAAVQKHSHTQQQHHLHRPSASDDHIHHPKRHKIFSTPTATRPSSRNIDDL
PESLLVEILCRLPCFKSVSQCKLVSKRWCTLLSDPHFIRLFLCVQRNRKKKPTGSAISIQ
GEEFLSRVSPSSRPLAQLFKGLVSIHGLKQEPIVVGAYNDLVLCCASEYSQRDYYICNPH
TVQWVPLPPPPQVYGYKFRVVRLIDPRVDDDDDDDVVSCEIEAQIFFSETGEWREFVLSS
PSAIAVGDLCRESIGVASNKMXYWLGGXGEFLIGFDPFMIDNSDNTRTHYKCFFSECGEW
DSGLMDSLVTXDGRXXMCXYXSPTRTLSIWEVYEAKXGDQTVMIHGGAGSLCVRRYKSVY
LGDEEMVVISPNINHIRAVVFDPNXEDLVYLVIDSTRDWNKKDVIRCNTRTREMSKVSTN
QTICCLHLFPFVLPWWPTPVRQXPQRGEPRPNLST
Download sequence
Identical sequences MDP0000165802 MDP0000165802|PACid:22635978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]