SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000168437|PACid:22624648 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000168437|PACid:22624648
Domain Number 1 Region: 55-227,321-431
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000168437|PACid:22624648
Sequence length 487
Sequence
MVYLNIVCAVIASLLGFVFLCSLRRQKKARAHQNGNCLKSCENGTCDEAKMVESADIIVV
GAGVVGSALAYTLGKDGRRVHVXERDLSEPDRIVGELLQPGGYLRLVELGLEDCVNEIDA
QRVFGYALYKDGKSTKLPYPLENFHPDVAGRSFHHGRFIQRMREKASSLPNVRLEQGTVT
SLLEEKGTVKGVQYKSKGXDLELSAHAPLTIVCDGCYSNLRHSLCNPKVDIPSCFVGLVL
ENCQLPYANHGHVILADPSPILFYPISSTEIRCLVDVPGQKVPSISGGEMSRYLKTKVAP
QVPPELYAAFMAAADKGNIKSMPNRSMPAAPRPTPGVLLMGDAVNMRHPLTGGGMTVALS
DIVVLRNLLRPLHNLNDAPALCKYLESFYTLRKPVASTINTLAGALYRVFCASPDPARME
MRQACFDYLSLGGVFSNGPLALLSGLNPQPLSLGASGIIFPIINSEGVRQMFFPVTVASY
YRTPPIN
Download sequence
Identical sequences MDP0000168437 MDP0000168437|PACid:22624648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]