SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000168505|PACid:22672316 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000168505|PACid:22672316
Domain Number 1 Region: 21-57
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000117
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000168505|PACid:22672316
Sequence length 65
Sequence
GIEDAVRIRQTVIDCFERTSLPSVSEEEKKKLLSFVCVGGGPVGVEFAAELHDFVKEGGV
CCRAS
Download sequence
Identical sequences MDP0000168505 MDP0000168505|PACid:22672316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]