SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000170414|PACid:22675630 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000170414|PACid:22675630
Domain Number 1 Region: 1-252
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.2e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 
Domain Number 2 Region: 357-515
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000738
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000170414|PACid:22675630
Sequence length 518
Sequence
MGKQVAIVGAGISGLLACKYTLSKRFQPIVFESTSSIGGVWIKTVESTKLQTPKPLYQFS
DFPWPSSVEXDFPSQHQVLDYIQSYAQHFDLLKHIKFDTKVCGIEYEGASEDEMQAWSHW
GGTGEPFSSXGKWKVAVEDKHSRSTEVYLVDFVILCIGRFSDVPNIPEFPFNKGPEAFHG
EVIHSKDYAAMDYERARNFVKGKRVTVVGFQKSALDIAMECSNANGIEHPCTVIYKTEHW
TLPDYLPWGVPLTYLYVNRFSELLIHKPGEGILLGLLATILSPLRWGFSKFVESYXTKKL
GLAKYGMVPKHCFLQEISSCLISTIPEKFYDRVQEGSIILKKSPXSFSFCQEGVLVEGEV
SPVKTDXVILATGFRGDKKLKDIFXSPTFQDYIAGSPEAILPLYRECIHGRIPQLAVIGF
SESLSNLCTSEMRCRWVAELLGGTFTLPSIKEMEKDVNEWDGFAKRYAGKYYRRSCNGTV
HIWYNDQLCKDMGWNPKRKKGLFAELFEPYGPLDYAPS
Download sequence
Identical sequences MDP0000170414|PACid:22675630 MDP0000170414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]