SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000172495|PACid:22647246 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000172495|PACid:22647246
Domain Number 1 Region: 385-445
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000128
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.005
Further Details:      
 
Weak hits

Sequence:  MDP0000172495|PACid:22647246
Domain Number - Region: 454-542
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0109
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000172495|PACid:22647246
Sequence length 564
Sequence
MCHPAGRTTMRRFTRLQGLRCVRSVLEKKMYWGLELWKWSVLVLVVLCGGLVTEWFINVL
VFVIELNFLLKKNVLYFVNGLKRSVQIFIWLGLVLLAWGLLFHRGVKRSRKTSRILGYVT
RGLASCLIGAGIWLVKNLFVKVVASLFQCNRFFDRIQESIFHQYVVXTLSWISLMERCKQ
VRKIPSRGQLSFKNLKGGKKEGKGGLKEEVIDVEKLKKMNQKKISARTLKGLINVVRSSG
LFTISDTLESEESEQKGKEITSEXEAKDVAKHIFQNVANHGERRSTMYXICLKGHQKLAR
SKKKAFKKWLVKVYLERKSLSRSLHDSKTAIEELNRLASGVFLLVIIIVWLLMMGFLTTN
ILVFISSQLLLMAFVFGNTAKTVFEAIIFVFVRHPFDVGDRCVVDGVQLVVEEMNIMTTI
FLRYDNEIISYPNSVLASKPISNFSRSPDMGDSVEFXVHVSTTADTIVALKARIKEYLDS
KSQHWRPAHSVVVKDIEDVNKMKMALYVTHTMNFHNYPEKSSRRSDLVLELKKIFEDLGI
KYKLLPQEVHLRYVGSSTAELPPM
Download sequence
Identical sequences MDP0000172495|PACid:22647246 MDP0000172495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]