SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000173151|PACid:22632672 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000173151|PACid:22632672
Domain Number 1 Region: 140-252
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-42
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000173151|PACid:22632672
Sequence length 708
Sequence
MAGLIDLNSATEDEETPSSGSPSSASSVSDALGSSASVCMELWHACAGPLISLPKKGSVV
VYLPQGHLEQVSDFPTSAYDLPPHLFCRVVDVKLHAETGTDDVFAXVSLVPESEEIEHRL
REGVTDADAEEDVEAMGTSTTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYTQQR
PSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGDDGELR
LGIRRAAQFKSSATCPTLCSQQLNYSTITDVVNAIFAKNAFNVYYNPRSSSSEFIIPSHK
FLRSLDHCFCAGMRIKMRFETEDAAERRYTGLITGISELDPVRWPGSKWRCLVVRWDDXD
TSKHGRVSPWEVERSGSVSSSHTLMTTGLKRSRIGLSATKPEXPXPSMSCNXGIGTSDFG
ESLRFQKVLQGQEISGFDTPFSGLGGLNSHPSEARRVFHGSGGSGIAAGGNGLRQSLVDS
EIASKGIGFGESFRFHKVLQGQEIFPSSPYGRAPASNEAHEYGGPGLYDGFQVPGFRNGX
STMMQSNNTNVHSSAPSVQVSSPSSVLMFQQAMNPVAEFNSVYNGHNQEDHRVNRTPHVL
EHDGGRQTSSSFGERNFSREDRGGTHSYNQHGISPHPVISQSTISGSQDSVSPIKGSCRL
FGFSLSEDKCVPDQEGNPNVGVQFHSKPPLMTSTVGITCTKVSNLFAA
Download sequence
Identical sequences MDP0000173151 MDP0000173151|PACid:22632672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]