SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000173300|PACid:22648712 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000173300|PACid:22648712
Domain Number 1 Region: 240-513,683-745
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-49
Family FAD-linked reductases, N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000173300|PACid:22648712
Sequence length 749
Sequence
MRKVCHPLLNGGRGYAGDDRKYSHGFSSAEMQSLASICEALLPPFYETKGEQPTINKAVQ
SFYKTSAAQTPIPDEVAQLMVKRALIEAVVLVRVVLWILGTKLGTLLLCGSLCFGKTWPF
VHKFSSLSLEKREKVLQKWFKHKFLTPIRLAFVYIKFLCLYIFFSRVGENAENPIWQAIG
YHVETDDQDDQKNHSKMQEQKRPLQKGIIETRLETDTSLLNSLXQKGFQVIHXSTKNIYN
VKCDVIIVGSGCGGGVAAAALASSGHKVIVLEKGNYFTPSDYSSLEAPSHDHLYESGGIL
VTVDGKIVLQAGSTVGGGSAINWSACIKTPNYVLQEWNKDHKIKFFGGSEYLSAMDTVCX
RIGVTENCVEEGFQNQVLRKGCENLGLGVDFVPRNSSENHYCGSCGYGCRKGEKKGTDST
WLMDAVDYGAVIITGCKAERFVLETNKSXSKRKKKCLGVMAKPLSNNITKRLQIEAKVTI
SACGALLTPPLMLSSGLKNKNIGRNLHLHPVLMAWGYFPDSNSEFKGKNYEGGIITSVYK
VVSXDSKVKAIIETPALGPGTFSALSPWVSGEDIKNRMLKFSRTAHLISIIRDKGSGVVT
KGGRVSYEFSALDKENIKGGLRQALRILIAAGAIEVGTHRSDGLRLKCKGIDKEELEEFL
DMVTADEGPQSLVENWTIYSSAHQMGSCRMGXNAKEGAVDENGESWEAESLFVCDGSVLP
SAVGVNPMITIQSTAYCLSKRIADSLRKC
Download sequence
Identical sequences MDP0000173300|PACid:22648712 MDP0000173300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]