SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000174905|PACid:22667024 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000174905|PACid:22667024
Domain Number - Region: 78-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0942
Family B3 DNA binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000174905|PACid:22667024
Sequence length 140
Sequence
MIAKNSSSAAIIGPSRTLSLAMYVESKRVRVWTESKQVMVATVERGWKILVLGSKSHELA
DEWSHFSLDFSWLPFIILLFSSFQGMSQQPSIQNATPKDLQGYKWRFRHITQGEDESGLE
RLHQCADNELQVCLNDKEFQ
Download sequence
Identical sequences MDP0000174905 MDP0000174905|PACid:22667024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]