SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000176581|PACid:22669985 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000176581|PACid:22669985
Domain Number 1 Region: 52-143
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-20
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 255-322
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000314
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 3 Region: 324-406
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000373
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000176581|PACid:22669985
Sequence length 439
Sequence
MASSFQDYISADTKKLDPTEVCDEVNAIPDLSEEEQIKACAWLIEDDKQFLMLKTLPIKK
RKNMRIPKKFVMKYGEGISNPVCLKLPSGSEWIVELRRWDGEVWFDNGWPEFSKFYSLDC
GHWLVFRYEGNSKFNVCIFDKSCTEIEYPLTMPKMELTSHDESRXNSANDSSDDYGDDXS
YKSGDGSDDNSAMILDKFLPCPRKTREKSTLPYPQPHKKRITSSSGKCDFPTEKYGVTXS
TXSGXVVALRRAIAFKSQNPSFIVVMRLSYIXSGXLWLPXKFCKLRPIKESCEVILQVSX
GRTWTVDXRYEEGKATFRRGWMXIFLPSDFHKLXHIKKSCEXILQVSNVGTWPVDLNYFS
EGKKAKFGRGWMEVVRDNNLESGDVCVFVSTNNSPKPLFDVVFFRSGQAAKRTNIDREKI
VPAEMEENVDAAGDSVQIL
Download sequence
Identical sequences MDP0000176581|PACid:22669985 MDP0000176581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]