SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000179251|PACid:22658518 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000179251|PACid:22658518
Domain Number 1 Region: 16-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-17
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 157-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000412
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000179251|PACid:22658518
Sequence length 259
Sequence
MADWSRFMARSPPFPRKFFKPLTPGFQNGMAIPIAFTRSLGEKKLDKALIKSCQGSWDVQ
VRRTCDGVFCFKQGWKEVVKNHSLEVGEFLVFEHKGNMVFNVKVYEPLGCXKXFPPPSFR
LIMAKTHWNVKCPSAYSYWAYSRLRSFSFSPSQSCHIRLLVQTIPLDFARSTGILDKSCM
RVKDPFGKLWPMDIGIVKDKEKIEAAWSRRTYLKSKGWIEFYKANKLKDADVCIFELIQV
PKSRSKPVIMNVKIFRFGS
Download sequence
Identical sequences MDP0000179251|PACid:22658518 MDP0000179251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]