SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000179649|PACid:22675194 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000179649|PACid:22675194
Domain Number 1 Region: 542-602
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000177
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.005
Further Details:      
 
Weak hits

Sequence:  MDP0000179649|PACid:22675194
Domain Number - Region: 611-699
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0157
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 151-226,477-532
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0333
Family ABC transporter transmembrane region 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000179649|PACid:22675194
Sequence length 721
Sequence
MEGGKGVGEKKGTNDVVLQISGGEEHTRYSNEIRDSNLQLTELQSLRVSGSASPEIPGPS
PSPPKIPAETTSRRASFSRSAFSKPKSRFVEPVXPXEKKATDEIPQLKSTANSPNVSSSX
EDDDEEVYKXARLKVREKCGKKMKKLALIELIAFVCIVGFLIACLTVPKLEKKMYWGLEL
WKWSVLVLVVLCGGLVTEWFINVLVFVIELNFLLKKNVLYFVNGLKRSVQIFIWLGLVLL
AWGLLFHRGVKRSRKTSRILGYVTRGLASCLIGAGIWLVKNLFVKVVASLFQCNRFFDRI
QESIFHQYVVXTLSWISLMERCKQVRKIPSRGQLSFKNLKGGKKEGKGGLKEEVIDVEKL
KKMNQKKISARTLKGLINVVRSSGLFTISDTLESEESEQKGKEITSEXEAKDVAKHIFQN
VANHGEHIEKEILLNHMKKEEVDNVLNLFEGAPETGKIKKKAFKKWLVKVYLERKSLSRS
LHDSKTAIEELNRLASGVFLLVIIIVWLLMMGFLTTNILVFISSQLLLMAFVFGNTAKTV
FEAIIFVFVRHPFDVGDRCVVDGVQLVVEEMNIMTTIFLRYDNEIISYPNSVLASKPISN
FSRSPDMGDSVEFXVHVSTTADTIVALKARIKEYLDSKSQHWRPAHSVVVKDIEDVNKMK
MALYVTHTMNFHNYPEKSSRRSDLVLELKKIFEDLGIKYKLLPQEVHLRYVGSSTAELPP
M
Download sequence
Identical sequences XP_008388551.1.92800 MDP0000179649 MDP0000179649|PACid:22675194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]