SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000181381|PACid:22662070 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000181381|PACid:22662070
Domain Number - Region: 290-340
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000357
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number - Region: 207-274
Classification Level Classification E-value
Superfamily Activator of Hsp90 ATPase, Aha1 0.0785
Family Activator of Hsp90 ATPase, Aha1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000181381|PACid:22662070
Sequence length 437
Sequence
MLMSSRSLRRTEDLDDDDGLSPFDMLAKXICTIASRKIKLLQETQENSXLPLKKRRSYFD
FLNIMPSPSPTXSNTNTNPNSPKEGNGLVIVREKGHILESSSGQVGSGSHEEEEKSGNQQ
EEEHQPLLPNKKCSHSNIQEIPDLLEECCPHPKKPRSPTKAKSIILFGKELTIATDIPVS
TRASGTELDYVHEAQTMIGDKDNLKRKYIDVDDGEDHVGPAHLNEKKKKVKFVFNNNLNA
TNKVVKKGKNKVVTASNANRIQEFLKPNEKEELDKTSLLMVPLIGPKLEPDKVSLGLWTM
SSKSQKTYVLKXTWFGIVERHSLGVGDVVQVWSFRATNPKYKIKDGDHGDHDHLTCNDDQ
LHLALVLVERGDRLLEEGGSKEGGTSTGGVSSSMSNNECDEGRKTIDGSSSGSCTPENDG
NSSPKPSCEERDQETFN
Download sequence
Identical sequences MDP0000181381 MDP0000181381|PACid:22662070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]