SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000181673|PACid:22646891 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000181673|PACid:22646891
Domain Number 1 Region: 1-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-61
Family GDI-like N domain 0.0000000345
Further Details:      
 
Domain Number 2 Region: 390-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000181
Family GDI-like N domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000181673|PACid:22646891
Sequence length 444
Sequence
MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDK
PPAHLGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPA
TDMEALKSPLMGLFEKRRARKFILYVQDYSETDPKTHEGMDLTRVTTRDLIAKYGLDDNT
VDFIGHALALHRDDRYLNEPALDTVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFAR
LSAVYGGTYMLNKPECKVEFNEEGKVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVAR
AIAIMSHPIPNTNESHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAET
DHPETELKPGIDLLGPVDEIFFETYDRYEPVNEPALDNCFISTSYDATTHFESTVLDVLN
MYTLITGKVLDLSVDLSAASAAEE
Download sequence
Identical sequences XP_008354312.1.92800 MDP0000181673|PACid:22646891 MDP0000181673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]