SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000182589|PACid:22648509 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000182589|PACid:22648509
Domain Number 1 Region: 5-52
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000162
Family FAD-linked reductases, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000182589|PACid:22648509
Sequence length 92
Sequence
MKKKMFTSIDCVVVGGGISGLCIAQVLATKHGDVVPIVIVTKAKDQVGGNIIIVEKDGYA
GAETRLRLERKDPTKLSCGFGEDKQAGVYRIK
Download sequence
Identical sequences MDP0000182589 MDP0000182589|PACid:22648509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]