SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000182702|PACid:22680484 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000182702|PACid:22680484
Domain Number 1 Region: 116-352,394-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.33e-27
Family GDI-like N domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000182702|PACid:22680484
Sequence length 458
Sequence
MKDLHINTTQSRTPADAISKTPKIDPKRQNILRKKKREKGIKGPSRSGPCDFRQCQSRRP
WHRFKEFLFLIKRTSGNLLKVGSYYHEEHCILIETRMHGNVIADILYSTISCKHATGNLN
LITQALAAVGCEMPVIPDPTTVHYHLPDNLSVLVHREYSEFISERTSKFPHEKQGILKFY
GVCWKVFNASNSLELKSLEEPIYHFGQFFQKPVECLTLAYYLPQNAGDIACKYIQDPQLL
SFIDAEVMCDRHYGGINYPIGGVGGIXKSLAKGLVDQGSQILYKANVTNIIVDPGRVVGV
RLSDGREFFAKTIISNATRWNTFEEDFQKVYVQAPSFLSIHMEVKAEVLPPETDCHHFVL
EVGTPKTHRRYLARDKGTYGPIPRNTPKGLLGMPFNTTAMDGLYCVGDSCFPGQGVIAVS
FSGVMCAHRVAADXGLEKKSPVLDAALLRLLRWLRTLA
Download sequence
Identical sequences MDP0000182702|PACid:22680484 MDP0000182702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]