SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000182973|PACid:22649063 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000182973|PACid:22649063
Domain Number 1 Region: 35-276,387-432
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.04e-36
Family FAD-linked reductases, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000182973|PACid:22649063
Sequence length 435
Sequence
MLKSTLDRIVRSHRNVTSSCSISISSISGVPKEKVDCVVIGAGVVGLAVARELALKGREV
LVLDSAPTFGTSTSSRNSEVIHAGIYYPTHSLKAKFCVRGRYLLYKYCSEHNIPHKQIGK
LIVATGSSEIPNLHNLMHRGIQNGVDGLVMMEGSEAMRMEPELACLKALLSPLSGIVDTH
SLMLSLVYLSPLIPIWVQGEAENHGTTFSYNTTVIGGHIQQNHXCLHVSGTKTLENWNRK
FPLQPEMILIPKLVVNSAGLSAPALAKRFDGLRTEHIPPSRLARGCYFTLSNTTICPFRH
LIYPLPEDGGLGVHVTLDLNGQVKFGPDVEWIDGVDDVSSFLNKFDYSVCTNRKELFYPE
IRKYYPNLKDGSLEPGYAGIRPKLSGPRQSPVDFQIQGEDVHGITGLVNLFGIESPGLTS
SMGIAEHVATRFFRG
Download sequence
Identical sequences MDP0000182973 MDP0000182973|PACid:22649063 XP_008392508.1.92800 XP_008392509.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]