SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000185338|PACid:22637072 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000185338|PACid:22637072
Domain Number 1 Region: 54-321,494-551
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.58e-48
Family FAD-linked reductases, N-terminal domain 0.000000423
Further Details:      
 
Domain Number 2 Region: 329-498
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.88e-32
Family GMC oxidoreductases 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000185338|PACid:22637072
Sequence length 559
Sequence
MPRPISFYLLHLAFFFVFLNAIVAEARTRGSHRSHQEPSYLKFVVNATDFPTEDYYDYII
VGGGTAGCPLAATLSSRFRVLLLERGGVAYGNRNLMTKEGFLATLMDVNSLDSPTQAFTS
EEGVANVRGRILGGSSAINAGFYSRADQDFYMKTSVDWDLQMVNESYEWVERAIVFRPEL
RTWQSAVRDGLLEAGVDPYNGFNLDHVVGTKIGGSTFDTLGRRHSAADLLNYAKPLNIKV
VTHASVERILLASTGPSPASRQSAVGVVFRDSVGRYHHAVLREHGEVILSAGAIGSPQLL
LLSGIGPRPYLSSWGIPVAHHLSYVGQYLYDNPRNGISIVPPIPLEHSLIQVVGITESGA
YIEAASNVIPFAPPARSVFIRTPSAPLYLTVATLMEKTIGPTSAGSLRLASTDVNVNPIV
RFNYFSNPVDVHRCVNGTRKIGDILKTRSMEDFKFQGWFGNKDFRFVGPALPVDQSNFEL
MADFCRRTVSTIWHYHGGCMIGKVVDGDFRVIGTDALRVVDGSTFGISPGTNPQATLMML
GRYVGLRIMKDRKEYKMID
Download sequence
Identical sequences MDP0000185338 XP_008380352.1.92800 MDP0000185338|PACid:22637072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]