SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000187657|PACid:22625109 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000187657|PACid:22625109
Domain Number 1 Region: 124-196
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000051
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 13-58
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000445
Family GCC-box binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000187657|PACid:22625109
Sequence length 242
Sequence
MEQMVQVQTSCMPFSRWGAQIYGKSHRVGLGTFNDEEEAAKTYDIASLKFRGLDAIINNS
RNKMKPYERDVTEALFLESHSKAEIVDMLRKHSYANELEIYKYKLYSGGAHYLXLRDTCS
SGRELLFEKVATPSDVGXLNRMVIPNNMPRSIFRMRWGKCGGLDIAIGVVVRASYVLSKG
WIRFVKEKKLKVGDVVRPRNLDISGIREMHGRVGDPLRTVQDHGVVRLFGVNISRKPVHC
RE
Download sequence
Identical sequences MDP0000187657|PACid:22625109 MDP0000187657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]