SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000189426|PACid:22643793 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000189426|PACid:22643793
Domain Number 1 Region: 83-185
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 287-381
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-18
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000189426|PACid:22643793
Sequence length 385
Sequence
MVVDLGEDVWGGFGKRRYKFELGMKFQVGEWVWGNELGMGLGSRIGRERGGHYLLGHIRS
ISGPAWVLQLSSGKMVKNKSTNDEKKPSFFRILVAGYNTEYLHIPRDFLKHIQKDLSERA
FLTLTDSLDCSWSVKVSRTTMGAVRFTDGWHEFLRDNSLGHGNFVVFIYDGRMKFSIRVF
GMNACEREVGSTKIGSTNQNSTFADTTKMPSGGGGQRKCDGSSSKRPHPSSSCSNDDSGE
NLCEPEEDDEDSTSNDWDDDEDNTSDEESEDDTSEEDMEAAAESESFKSKFPHFKSVIRT
SSNVYVPAAFSRKHFSKQKHFKIFMKNAEEKTWAVNVVHLNTSHSFSAGWSRFASSNQIG
IGDTCIFELLSSNEMKVRIIQKASV
Download sequence
Identical sequences MDP0000189426 MDP0000189426|PACid:22643793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]