SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000190684|PACid:22677586 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000190684|PACid:22677586
Domain Number 1 Region: 11-175
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000190684|PACid:22677586
Sequence length 200
Sequence
MQIDVLQEDGKVLFVDGSWIIADTIIYCTGYSYTFPFLDTKGIVAVDDDRVGPLYEHTFP
PSLAPFLSFVGIPRKIIGFPFFESQAKWTAQLLSGKTTLPSRDDMMQSIKEFYHSRDVAG
IPKHNTHDIAEFEYCDRYGDHIGFPHLEEWRKELCLSALRNADTDLETYRDSWDDHDLLQ
EALQSPHFTQLGPQDFDFPI
Download sequence
Identical sequences MDP0000190684|PACid:22677586 MDP0000190684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]