SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000192359|PACid:22632529 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000192359|PACid:22632529
Domain Number 1 Region: 23-260
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.14e-24
Family FAD-linked reductases, N-terminal domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000192359|PACid:22632529
Sequence length 291
Sequence
MASSSGTGASMLFFLVLLCFKFWLYLYHSNLRGRVLGGGSAINGGFFSRASDDYVKRVGW
NKQMVSDAYKWVESRNAFKPKLTPWQYVAELSFLEAGIFPYNGFSLDHIKGTKIGATTFD
EQGRRHTSADLLTAGNPNSITLLLNATVTSIIFHEKGSRYETIVRGIRFIKSDGSSSQTH
EAYLNTQNNSRSSTGDVILAAGALGSPQILLLSGIGPQKHLNKFNIPVAVNLKSVGKGMT
DNPCIALLAEIADAKPKNFPPDSPKLEVEELRQVQEVSNDSLKSVYIMKKS
Download sequence
Identical sequences MDP0000192359 MDP0000192359|PACid:22632529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]