SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000194603|PACid:22651584 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000194603|PACid:22651584
Domain Number 1 Region: 119-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-40
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 582-663
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000235
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000194603|PACid:22651584
Sequence length 702
Sequence
MAHLECDSSISRAETDLRGDDLYTELWKLCAGPLVDVPRPGEKVYYFPQGHMEQLESSTN
QELNQQIPLFNLPSKILCSVVHIRLLAEQETDEVYAQITLHPEADQCEPSSPDPCKPEAP
KATVHWFCKILTASDTSTHGGFSVLRKHATECLPPLDMNQATPTQELIAKDLHGYEWKFK
HIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLRGDNGELRVGVRRLARQQSQIPSSVI
SSQSMHLGVLATASHALMTKTLFVVYSKPRTSQFIIGLSKYLEATKTKFSLGTRFRMRFE
GDESPERRCLHGSRRFTGTIVEVGDLSPQWSESKWRSLKVQWDEHAAVQRPDRVSPWDIE
PFVASAPSNLAQPMVKSKRPRPVEISSSEVTTNSAASSFWYHSSPQTTELNRGGVPEVQT
SGSQVVWPLRQKESNSSSYSSARVCSEGIWPSSPHVDVPLSLFRDSKESSKNVIAGSVLS
SIASPILSKPNNVLIHDQVEKGKKSDSSGFWLFGCNLSNNTKTTCPQEIEPVFKTMPSGA
KGPIPADAFESDQGLDVSKLSKEQKQVILEASPKETQGKQGLTLSTRTRTKVQMQGVAVG
RAVDLTALKGYDHLIDELEKMFEIKGELRPKNKWAVVFTDDENDMMLMGDDQWPDFCKLV
KKIFIYSSDEVQKMNRCKLQSSSLDCEGTVSVDSLSIDRKHD
Download sequence
Identical sequences MDP0000194603|PACid:22651584 MDP0000194603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]