SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000194622|PACid:22683388 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000194622|PACid:22683388
Domain Number 1 Region: 264-424,519-646
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.59e-32
Family HI0933 N-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000194622|PACid:22683388
Sequence length 680
Sequence
MALDTKELQKLQVGEVLVGDKNSRASMPRSDTRTTTEKSSPAAELPISDFDCFSLTFSXF
XLFFSQFLSVSFCVSXMNCLAWRIEEETNEDHRTRVPTWTKNSGRPPQTHMSLSSLRLRT
GHTHISFTFTISLGNFLISLGSSKIFSNCKDCSCFNTALLVALPVSRDIRDKCWNFMDTL
LKTHNKLAFLHPIHGFSEKLSSSSSSKLRNEEFGYGLRRSRVKLSRGGVVKASSSALLEL
VPEIKKESLEFELPLYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIW
PNNYGVWVDEFEAMDMLDCLDTTWSGAVVYIDEESKKDLNRPYGRVNRKQLKSKMLQKCI
SNGVKFHQAKVTKVIHEEEKSLLTCNDGVTIQASVVLDATGFSRCLVQYDKPYNPGYQVA
YGILAEVEEHPFDVDKMLFMDWRDSHLNNNIELKERNGRIPTFLYAMPFSSNRIFLEETS
LVARPGLPMKDIQERMAARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGGTAGM
VHPSTGYMVARTLAAAPIVANAIVRYLGSDRTLSGNEVSAEIWKDLWPIQRRRQREFFCF
GMAILLKLDLKGTRRFFNAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNASRIEI
MAKGTPPLVKMINNLIQDRD
Download sequence
Identical sequences MDP0000194622|PACid:22683388 MDP0000194622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]