SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000196881|PACid:22654963 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000196881|PACid:22654963
Domain Number 1 Region: 139-185
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000576
Family FAD-linked reductases, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000196881|PACid:22654963
Sequence length 244
Sequence
MGGSGGFYYLQLALAINEEDGAPTTPRSGIYSRNNPHHEEIRGRRCSGGEEGGSSGRQKK
MQMVILNPSNSSCGKKKNQSRRTGFAGRIEEEEEEEYDGREPAFLLCRFARGGIWFWDLW
EGGGRTEGGNTKKKKFIFVDCVVVGGGINGLCIAQVLATKHGDVVPNVIVTEARDRVGGN
IIIVEKTTILEQRQRLRLERKNTKLYRGFGEDKQVVVQQDHGVPPSMTNKDHPKWLKSAL
FQMG
Download sequence
Identical sequences MDP0000196881 MDP0000196881|PACid:22654963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]