SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000196888|PACid:22670849 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000196888|PACid:22670849
Domain Number 1 Region: 121-155
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000117
Family Thi4-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000196888|PACid:22670849
Sequence length 164
Sequence
MDRVKESTNLFDQEEEDQRLASRPELYTEKKCRRVTDFHQRCHRPTRRCNASLTWVVLED
PHSHFSELPMVPGPPWSLNGSAPAYECVLAGVLVSLLSSXFFVIINTTFGEKKKVDVANV
SATGVFLTPEIEXSTDVVIVGAGVAGAALAYTLGKVIIISLSLS
Download sequence
Identical sequences MDP0000196888|PACid:22670849 MDP0000196888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]