SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000199159|PACid:22674497 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000199159|PACid:22674497
Domain Number 1 Region: 8-227
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.72e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000199159|PACid:22674497
Sequence length 274
Sequence
MASETYQSKNVCVIGAGPSGLVAARELRKEGHSVVVLEQNHDVGGQWLYDPNVEGEDPLG
RSPTLKVHSSLYTSLRLISPREIMGFTDFPFAVKKGRDMRRFPGHTELLLYLKDFCDWFG
LRELIRFNTRVSYVGMLNGDHVVGCKDLKWVVKSVENKTESFVEEVFDAVVVATGHYSKP
RLPSIKGMDAWKRKQMHSHIYRVVVVVGTSLSGQDISMELVDVAKAIYLSGKSLDISEGL
SKVITKHENWHLRPQVQEISFYSETSRFVFRIGL
Download sequence
Identical sequences MDP0000199159|PACid:22674497 MDP0000199159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]