SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000199319|PACid:22658752 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000199319|PACid:22658752
Domain Number 1 Region: 53-225,319-429
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.79e-44
Family Thi4-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000199319|PACid:22658752
Sequence length 574
Sequence
MVYEYVLAGVLVSLLSSVFFFIINTTFSEKKKDGVANVSATGVFLAPETEKSTDVVIVGA
GVAGAALAYTLGKEGRRVHVIERDLNEPDRIVGELLQPGGYLKLIELGLEDXANESIDAQ
KVFGYALYKNGNDTKLSYPLETYSSDIAGRSFHNGRFIQRMRERAATLPNVKLEQGTVTT
LLEEKGTVKGVMYKNKAGEEMRTYAPLTIVCDGCFSNLRRSISTPNIENPSCFVGLILEN
CELPHANHGHVIXGDPSPILFYPISXTEVRCLVDVPGTKVPSVANGEMAWYLKTVVAPQV
PHQLLKAFLAAVDKGIIRTMQNKSMPAAPQPTPGAILLGDAFNMRHPLTGGGMTVALSDI
VLLRDLLRPLSDXNDAPAXCXYLESFYTLRKPVSSTINTLAGALYKVFCASPDPARQEMR
EACFDYLSLGGICSNGPISLLSGLXPRXINLFLHFFAVAVYGVGRLMIPFXTPKRMWLGA
RLXLSASGIIFPIIKAEGVRQMFFSATIPAYYRVPPAGKILLVNDTNIMXIPTRVRISVN
VPRLLGLGESAAFEGNYATVGLAKGKIGVIVCQL
Download sequence
Identical sequences MDP0000199319 MDP0000199319|PACid:22658752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]