SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000199343|PACid:22627154 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000199343|PACid:22627154
Domain Number 1 Region: 709-927
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.14e-60
Family Helical scaffold and wing domains of SecA 0.0000282
Further Details:      
 
Domain Number 2 Region: 82-252,376-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-51
Family Tandem AAA-ATPase domain 0.00000629
Further Details:      
 
Domain Number 3 Region: 414-523,611-703
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.81e-50
Family Tandem AAA-ATPase domain 0.00000982
Further Details:      
 
Domain Number 4 Region: 251-354
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 3.66e-28
Family Pre-protein crosslinking domain of SecA 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000199343|PACid:22627154
Sequence length 968
Sequence
MAVAPLPLVKHHQLSPLCSKFSHPLNLKNRQLGSSFFGGRTFQMPETSRMVCRRRRRMQA
VASLGGLLGGIFKGSDTGESTRQQYAPTVSVINGLEAQMSALSDSELREKTRLFQERAKQ
GESLDSLLPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGEGKTLVAILPA
YLNALIGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKSVEELVLRNFNYCVIDEVDSILI
DEARTPLIISGPAEKPSDRYYKAAKIAAVFEREIHYTVDEKMKTVLLTEQGYEDSEEILG
VKDLYDPREQWASYVLNAIKAKELFLRDVNYIIRGKEVLIVDEFTGRVMQCSLFSHVFCG
HGMIRGGAGVMDFTKQLKQKKFPKLCGMTGTAATESTEFESIYKLKVTIVPTNKPMIRKD
ESDVVFRATKGKWRAVVVEISRMNKTGRPVLVGTTSVEQSDSLSEQLQEVGIPHEVLNAK
PENVEREAEIVAQSGRLGAVTIATNMAGRGTDIILGGNAEFMARLKLREMLMPRVVKLTE
GGYVSVKKLPPKKSWKVNENLFPCKLSNEKTKLAEEAVKLAVETWGQRSLNELEAEERLS
YSCEKGPAEDQVIAKLRSAFLEIVKEYKVYTEEERKKVVSSGGLHVVGTERHESRRIDNQ
LRGRTGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGLMRAFRVEDLPIESKMLTKALDEAQ
RKVENYFFDIRKQLFEFDEVLNSQRDRVYTERRRALESDNLQSLIIEYAELTMDDILEAN
IGSDASKESWDLEKLIKKLQQYCYLLNDLTPDLLRSNCSSYEDLQEYLRLRGREAYLQKR
DIIESKAPGLMKDAERFLVLSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKLEGY
NLFLEMMAQIRRNVIYSIYQFQPVMVKKDGDQRENNNSVVTNGRRSNNNPDPLSSVDPSA
AATPQSSA
Download sequence
Identical sequences MDP0000199343|PACid:22627154 MDP0000199343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]