SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000201011|PACid:22661057 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000201011|PACid:22661057
Domain Number 1 Region: 500-1073
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.09e-91
Family Acetyl-CoA synthetase-like 0.00054
Further Details:      
 
Domain Number 2 Region: 1681-2052
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 4.84e-65
Family Allene oxide synthase 0.00034
Further Details:      
 
Domain Number 3 Region: 21-275
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.53e-28
Family FAD-linked reductases, N-terminal domain 0.038
Further Details:      
 
Domain Number 4 Region: 1596-1704
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.00000000000194
Family PglD-like 0.074
Further Details:      
 
Domain Number 5 Region: 1114-1194
Classification Level Classification E-value
Superfamily ACP-like 0.000000000327
Family Acyl-carrier protein (ACP) 0.0094
Further Details:      
 
Domain Number 6 Region: 1343-1427
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0000079
Family Galactoside acetyltransferase-like 0.014
Further Details:      
 
Domain Number 7 Region: 2192-2301
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0000139
Family Galactoside acetyltransferase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000201011|PACid:22661057
Sequence length 2311
Sequence
MDPGKSVEDQFSGLHPCLPLNTRIAIVGGGPSGLSSAYALVKLGYSNVTVLEKHHTVGGM
CESVDIEGKIYDLGGQVLAANSAPVIFHLAKETGSELVEMDSHKLALIDKSGQYQDIKVA
DDYVSVITLTLELQDKAAKSGRIGVHAVSEYASDLTPVYLERQGFSSIPKSVAYGYTASG
YGFVQDMPYAYIHEFTRTSMAGKIRRFNGGYTSLWEKISKSLPMVHCNTEVLAIRRYSDS
VSVDVKSCDGEVKALEFDKIIISGSFPLNNGKIYRSPPSQPTERGSEVMEMGDVEKELFS
KVQTIDYYTTVLKVKGIEDLPIGFYYFEEYMSNPATIGNPVAMQKFYADTDVLLFWSYGN
SVDVTGPTVTELALDAAKLIGAEVTEVVLQRRFKYFPHVGSQEMKDGFYEKLESELQGFR
NTYYVGGLMAFELTERNSSYAMGLVCKHFANDNPVPKFPYAKSLFALQQQWGGSPKSMTE
LPGVXFPNLSSLDGYLKHWGAHGVTQNXTXYTWINEEGAVVSQRTYAELHANASCIAQKL
LTCKKPRIRPRDRVLLVHVPGLDFVDAFFGCLRANVLPVPVLPPDPLQRGGQALLKIENI
AKSCGAVAILSTISYHWAVQAGSVKNIISLTAKKPKSTARWPNLPWLHTDSWIKNSKNVV
VEDFKDEFEPQPDEVSFLQFTSGSTGDAKGVMITHGGLIHNVKLMXRRYKSTSKTVLVSW
LPQYHDMGLIGGLFTALVSGGTAVLFSPLTFIRNPLLWLQTMSKYQATHSAGPNFAIELV
VRRLESEKNRKYDLSSMKFLMVAAEPVRQKTLKRFVELTCPFGFSQKVMAPGYGLAENCV
FVSCAYGEEKPIMVDWQGRVCCGYVNPNDEDVDIRIVDPESGEELKEAGKEGEIWISSPS
AGIGYWGREELSQKTYRNKLPDYPGRIYTSTGDLGRIIDRKLFITGRIKDLIIVAGRNIY
SADVEKTVESASEVVRPGCCAVIAVPMEILSMKGISVPDNADQVGLVVIAEVRDGKPVGK
DVVEQIQARVAEEHGVTVASVKMIRPKTISKTTSGKIKRFECLQQFTDGTLNVVPEPILI
KKKLMRSFTTGTCKEGITPRPQFVKGSPLPSPKISNKDIVDFLKRLVSEQTGISINKISN
TESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVMNSQPQLST
TPSNVPLLETETDSAELVMELPESHHLVIWSFQLLALIYVAFMLSIPAYLSVSAFMNCVS
ATHALVEGIPYLDYLTLLTFAPLAWMFCILSTCVSIGFXGNSFLKPNYALNPEVSIWSVD
FVKWWALYKAQEVASKVLAEHLRGTVFLKYWFEMLGARIGSSVLLDTVDITDPSLVSIGD
GVVIAEGALIQSHEVKNGVLSFLPIRIGQNSSVAPYAVVQKGTILGEELEVMTLQKSGGK
SAVKATNLQNGKTLPNVTKETQDVAVYQFIGIYIVGLLSTLSASIVYLVYIWMSQKPLSP
QEFAFACLFGAFHWMPYTVVAYATMFSNVPLGIIYSSISLAVXYLAYGIXLSFLTGALTR
LISSNQEKKTTHFRTWLCHRITIACHLRFAKLLSGTEAFCMYMRLLGAKVGKHCSVRAIN
PISDPKLISLGSGVHLGDFSRIIAGYYSSHGFVSGKVEVHDNSVVGSESVVLPGSVLQKD
VILGALSVAPVNSVLQAGGVYIGSQTPMMIKNTMHSLDDRIEEMDMKYKKIVGNLAANLA
ATTLKVKSRYFHRIGVSGKGTLKIYDNIKGLPDHKIFCPGKXYPVIVRHSNSLSADDDAR
IDARGAAVRILSDETSDSSLFDLTLKTGNAFYARTIADFATWLVCGLPAREEYVKRAPHV
RDAVWTSLRHANSYAELHYYSNICRLFRFEDGQEMYVKFKLRPSDENISEEAGKVEPIGI
LPPDTGAIPRNDNDTRPLLFLAEDFQSRVNAKGVRYIFQLQVRPVPHDEAARDIALDCTK
PWSESEFPYIDVGEXSINHNLSAEQSEQLDFNPFLXCHEVDVIRASSCSQSASIDHGRSL
IYEICQHLRNGAPLPEAWKIFIEQSDVKVDLSGCPMAAALMKKDAQNVTLERTLFQTLWA
TFAQPLLQTVLPHFLLALVIYAPLNWMLHLKNAQKVALHWLFPLFWVSSGLLAGLACVVA
KWLLVGKKKEGETVHIWSIGVFLDTTWQAFRTLVGSYFXEMTSGSIFFVLWMKLMGSEIE
LDQGAYVDSMGALLNPEMVEIERGGCVGREALLFGHIYEGDEGKVKFGRISVGEGGFVGS
RAIAMPGVRVEVGXSLSALSLAMKEEIIKSR
Download sequence
Identical sequences MDP0000201011 MDP0000201011|PACid:22661057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]