SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000201845|PACid:22662296 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000201845|PACid:22662296
Domain Number 1 Region: 114-180
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000275
Family B3 DNA binding domain 0.0081
Further Details:      
 
Weak hits

Sequence:  MDP0000201845|PACid:22662296
Domain Number - Region: 386-431
Classification Level Classification E-value
Superfamily Prefoldin 0.0248
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000201845|PACid:22662296
Sequence length 437
Sequence
MAMAVLQDQKQKQSSSCPRPPKVVSGSNANPNMPESRKRKRVTVAKSGVYERAREVEATL
DPRFPILLRVMLPSHVAGCFWLVNLKLSLILFTLCAVISTYQGLAFPRNSALIICQNKIR
RLFWKMKMGINLKTKYLAEKVGLSGGWRGFSIARKLQEGDAVIFHLVTPSKFKVYIIRSN
DLDDMDCAIDLVKLDASIKLADTGDVIACGREEREKLETIPKDSAIAFASKSGSISDHSG
NDIEDLGFEVLDGLRLSESNVAFKEVKSVENFNVLVNGLNINSEFSKHLLTKYYDLCCSQ
NSFLHELLIEGLNCKLISGAISETINIADAIRSCSVTTLGCNFSAWYKTLKAFEGLGMNV
GFLRTRLDQLVSLASRSKRFKEARLEKEQAEEEMRSLEAKLLVVKDAINILDSEIESLNT
SLEKLEHMFQEVAKAPW
Download sequence
Identical sequences MDP0000201845 MDP0000201845|PACid:22662296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]