SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000204596|PACid:22635084 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000204596|PACid:22635084
Domain Number 1 Region: 3-149,229-257
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-28
Family FAD-linked reductases, N-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 130-231
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.37e-19
Family L-aminoacid/polyamine oxidase 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000204596|PACid:22635084
Sequence length 644
Sequence
MDWHFANLDYGCAAPLKEVSLPNWNQDDVYGGFGGAHCIIKGGYSTVVESLGEGLQIHLN
HVVTDISYGTKDAGLNTNRYNKVKVSTSNGSDFSGDAILITVPLGCLKAETIKFSPPLPH
WKHSSILRLGFGVLNKVVLEFPGVFWDDSVDYFGATAEETELRGQRFMFWNVKKTVGAPV
FIALVVGKAAIDGQNMSSSEHVTHGIVVLRKLFGEASVPDPVAAVVTDWATCKEHPDTVG
DAMMSGLREAVRIIDILTTGNDYTAEADAIAGIQRQSDSERAEVRHITRRLDAVELSYVL
YTNKEALLQDMFFNAKTTKGRLHLAKELLSLPVETLKSFARTKEGLTTLNSWILVPCYPS
ANSQSEITTCNFQSSISQAGDYRQISPNPPXMSTTTTATAGSTNAPSGHSDLQEHREEGV
PARIISGIQFLYETMPHQFETMSFAATTKLLFKVLCYGXYIIXVGGGGPKVRGTFTFGKK
DTSTDLYSICSVKQNKIRSHAIGNQEVASGIDDGLRFEHGGQVSVRAERPRIGIGGLHGV
GRGRQNSGAGGDHRGGVAAAEGDISCDILLQICENSAPKIYWHVTFDFVKTQIKGDELST
AIALRDLDTCQVVIHQVNLLDRREEKELEXLKSELSLSLRCQLS
Download sequence
Identical sequences MDP0000204596 MDP0000204596|PACid:22635084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]