SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000207722|PACid:22671640 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000207722|PACid:22671640
Domain Number 1 Region: 252-347
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.76e-27
Family B3 DNA binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 127-184
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000438
Family GCC-box binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000207722|PACid:22671640
Sequence length 370
Sequence
MGRSRVRCSKLVSLIDCSYTQGEIPHSLSGLRNAFQIQTMFMQQQHMQISNFRFSPSKTL
PNLHIHVNIVFIFSLESIHNGRRCXNHHDLKCPKKSGFGNFRFKRNGFSLLHPNKRARHD
NGVSFAKFKGVVPQQNGHWGAQIYANHQRFWLGTFKSEKESAMAYDSVAVKLXNGKDLHI
NFPWNSFTVQELHFQNHYSTDAIMKMIRNGSYLSKFDAFVRSQIQSQIEEMGKGTNNPIR
VHGDGQVLCRQLFQKELTPSDVSKLNRLVIPKKYAVEYFPCICENVEVNGTEDIELVFYD
KLMRVWKFRYCYWRSSQXFAFTRGWNRFVKENNLKANDVITFYACESDDQVIREEDREST
TFWLIEVMDS
Download sequence
Identical sequences MDP0000207722 MDP0000207722|PACid:22671640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]