SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000211459|PACid:22629500 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000211459|PACid:22629500
Domain Number 1 Region: 128-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-47
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 775-862
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000334
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000211459|PACid:22629500
Sequence length 897
Sequence
MMGSVEEKLKTGCLLDEMKLLKELQDHSGSRKAINSELWHACAGPLVCLPQVGSLSYYFP
QGHSEQVAVSTKRTATSQIPNYPNLPSQLLCQVQNVTLHADKETDEIYAQMILKPVNSEK
DVFPVSDFRMKPSKHPSEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDFTMQPPTQEL
VVRDLHDNTWTFRHIYRGQPKRHLLTTGWSVFVGAKRLRAGDSVLFIRDEKSQLLIGVRR
ANRQQTTLPSSVLSADSMHIGVLAAAAHAASNRSSFTIFYNPRACPSEFVIPLATFQKAV
YGTQLSIGMRFGMMFETEESGKRRYMGTIVGIXDLDPLRWPGSKWRNLQVEWDEPGCCDK
QNRVSSWEIETPESLFIFPSLTSSLKRPMHSGFLGAETEWGNMIKRPFIRVPEIGNGNXX
PYPISNLCSEQLVNMLMKPQLANHAGTXAALQRESASNADSVVDMKAMYAKINQKNLADG
VNANAPSHELPPGRLNVAAKFGSQTPVGNGTEKTKLEPEFSADQLSQLNSVGHGIEDKLA
TGFASPYSXVNQLTFANQNQDAAQLQTSPRPMQPPLESLLFHSQTDLPHSDFNGMNSSLP
FLDNDECMFYSSCQSFSGALRSPGPLSAFGLQESSAVLTEANNSSLTSIGQDMWDNTLIN
SSSLRDLSDESNNQSGIYGCPSIDVGSCLSTVVDPSVSSTILNDFSTLKNSNFQNSSDCL
VRNLSSSQDLQSQITSASLGDSQAFSRXDLADXSGGTSSSNVDLDESSLLKNSSWHKVVA
PVRTYTKVQKTGSVGRSIDVTNFKNYEELCSAIECMFGLKGLLNDPRGSGWKLVYVDYEN
DVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAAMQGMNGTMSEXGRP
Download sequence
Identical sequences MDP0000211459 MDP0000211459|PACid:22629500 XP_008357134.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]