SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000212063|PACid:22630334 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000212063|PACid:22630334
Domain Number 1 Region: 337-440
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000114
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000212063|PACid:22630334
Sequence length 537
Sequence
MAGLQIDMEMQQLGKCVEQCLGRRTGVGWWRVGVLGSWKHLEKKEKQKNKKIMLMSSRSL
RRTEDLDDDDGLSPFDMLAKXICTIASRKIKLLQETQENSXLPLKKRRSYFDFLNIMPSP
SPTXSNTNTNPNSPKEGNGLVIVREKGHILESSSGQVGSGSHEEEEKSGNQQEEEHQPLL
PNKKCSHSNIQEIPDLLEECCPHPKKPRSPTKAKSIILFGKELTIATDIPVSTRASGTEL
DYVHEAQTMIGDKDNLKRKYIDVDDGEDHVGPAHLNEKKKKVKFVFNNNLNATNKVVKKG
KNKVKFASGMPAPDLXEEFKSLILGEMNGTKLQMLAQKSLYNTDINKDQGRLSLPRMQTE
SKNFLKPNEKEELDKTSLLMVPLIGPKLEPDKVSLGLWTMSSKSQKTYVLKSTWFGIVER
HSLGVGDVVQVWSFRATNPKYKIKDGDHGDHDHLTCNDDQLHLALVLVERGDRLLEEGGS
KEGGTSTGGVSSSMSNNECDEGRKTIDGSSSGSCTPENDGNSSPKPSCEERDQETFN
Download sequence
Identical sequences MDP0000212063 MDP0000212063|PACid:22630334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]