SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000213381|PACid:22663844 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000213381|PACid:22663844
Domain Number 1 Region: 53-225,319-429
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-44
Family Thi4-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000213381|PACid:22663844
Sequence length 574
Sequence
MVYEYVLAGVLVSLLSSVFFFIINTTFSEKKKDGVANVSATGVFLAPETEKSTDVVIVGA
GVAGAALAYTLGKEGRRVHVIERDLNEPDRIVGELLQPGGYLKLIELGLEDXANESIDAQ
KVFGYALYKNGNDTKLSYPLETYSSDIAGRSFHNGRFIQRMRERAATLPNVKLEQGTVTT
LLEEKGTVKGVMYKNKAGEEMRTYAPLTIVCDGCFSNLRRSISTPNIENPSCFVGLILEN
CELPHANHGHVIMGDPSPILFYPISSTEVRCLVDVPGTKVPSVANGEMAWYLKTVVAPQV
PHQLLKAFLAAVDKGIIRTMQNKSMPAAPQPTPGAILLGDAFNMRHPLTGGGMTVALSDI
VLLRDLLRPLSDFNDAPAVCAYLESFYTLRKPVSSTINTLAGALYKVFCASPDPARQEMR
EACFDYLSLGGICSNGPISLLSGLNPRPINLFLHFFAVAVYGVGRLMIPFXTPKRMWLGA
RLXLSASGIIFPIIKAEGVRQMFFSATIPAYYRVPPAGKILLVNDTNIMLIPTRVRISVN
VPRLLGLGESAAFEGNYVTVRLAKGKIGVIVCQL
Download sequence
Identical sequences MDP0000213381 MDP0000213381|PACid:22663844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]