SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000214280|PACid:22681133 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000214280|PACid:22681133
Domain Number 1 Region: 87-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-26
Family FAD-linked reductases, N-terminal domain 0.000000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000214280|PACid:22681133
Sequence length 338
Sequence
MSLCELFSPLMSLSHHRPTSIYRGGLVVHPRCTPNPTVYGVVVISAYFQMHVGSVFLNYG
CSFTYAGIINVSYTTGVTPLWSSSSIRDFGYLKFVYNATDLPLGXKYDYIVVGGGTSGCP
LAATLSAKYSVLVLERGXLPTAYPNXLNQDGFLYXLXQEDDGNTPVQRIMSEDXIPTVRG
RILGGTSMINAGVXARANISFYNESGIEWDMDLVNKTYKWVENTIVGRPNNSVGGWQSVA
QKAFLEAGGYDPNNGFVLDHIEGTRFTGDELLNKGDPNNLRVAVHATVEKIIFSTLSKKS
TXLSATGVIYRDSNGRSHRALVHDKGEIILSSGTIASP
Download sequence
Identical sequences MDP0000214280|PACid:22681133 MDP0000214280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]