SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000214352|PACid:22681236 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000214352|PACid:22681236
Domain Number 1 Region: 144-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-31
Family B3 DNA binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000214352|PACid:22681236
Sequence length 641
Sequence
MAPRTTGVEGPPRTATVNAGESSGCTDAAALPAANNDQGEKDDLYTHLWYACAGANVYVP
RPGEKVFYFLQGHXEQVEAYANQDGKMEMPRYNLPPKILCNVVCVQLKAEVHTDEVYAQI
TLLPVTEQDQLSVEEXNTPPLPXRTSTXSFSKTLTPSDTSSHGGFSVPKRQAEECLPALD
MSQQPPVQDLVAKDLQGNEWSFRHIFRGQPRRHLLTSGWTTFVTAKRLVSGDACIFASMQ
HGILASAFHAISTGTIFTVYYRPWTSPAAFIIPYDRYMKSAEIDYSIGMRFRMYSEDIED
NDYLRWPDSEWRCLKXRLDTASDTCFHSERLSPWNIVPLKPNKRARLPDLPSPGISSLAR
NGSLLISVESTRPRKKKVFQGQETSDPPAHEPGTPKQLLQFIPPPNPDWDYTXLGLENNL
NVPMNDSFYQCPGSPKAPSLTNQWPPMFGFGVFDSGACKRSMSVPNIWSSXSQKLRTFEL
XSETQSPLVQPKTTMLFGVKIVTSYPELPSPQVANSIELYSPCSTPPIYHSSVSETIQLS
ETSKSVSGVRSEKQCRKCCSVSNRSRIKVLKHGAPVGRSIDLTRFDGYNELIRELDQMFD
FKGSLIGGSSGWQVTYMDDVGDRMLVGDYPWQLRTRTYAVT
Download sequence
Identical sequences MDP0000214352 MDP0000214352|PACid:22681236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]