SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000214729|PACid:22665914 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000214729|PACid:22665914
Domain Number 1 Region: 183-285
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-19
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 4-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-18
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000214729|PACid:22665914
Sequence length 353
Sequence
MARKPKKPSFIKILAGDTSQGLRVPPAFIMKNFNGRSLCKCDLKGPTGIRRTVELEEREN
GLFFHDGWQGFVKDHLLEAGDFLVFXYDGVSKFNVKIYDRSACEKDVEVAKMNKGNQARR
KVEVVDIDTENVKAEVVDIDTVNYSQDREKQMIFSSWSCDHLKSRKRPVSNYVEDTSTAS
ILLETENPCFLHFLNHRNRLYNVRIPKQLALDEGLTDKDSVTLQDPDGRSWFVRLRTHYT
DRFDYLNLSTGWRECGKANQISLGDTIVFEFVKQSVIQVHIFRKGEVRGNVCRLRESDVG
GGRERXAGGGRECEGELRESLQRGEVRGKWASVCDFSLIPRLLCDEQKIFVPQ
Download sequence
Identical sequences MDP0000214729|PACid:22665914 MDP0000214729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]