SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000215521|PACid:22667208 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000215521|PACid:22667208
Domain Number 1 Region: 14-118,148-257
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.99e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.054
Further Details:      
 
Domain Number 2 Region: 354-528
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000907
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000215521|PACid:22667208
Sequence length 555
Sequence
MAAANAHHLHSVSKIGIIGAGISGIVATKQLLGHNPVVFEATDSIGGVWKQCSYNSTKLQ
SPRCNFEFSDYPWAERDNSSFPSHVEVLEYLHGYATHFDLLKYVKFESKVVEIRYVGGID
DHQTITQLPMNSISGEYGSLLSGHPVWEVAVQMSNIPNIIQWYAFEFIVVCIGKYGDIPR
MPSFPRNKGQEVFQGKVLHSMDYSKLDQRAARELLKGKKVAVIGYKKSAIDVAVECAEAN
QGPDGEACTMVIRTPHWTVPSYWIWGLPFFLFFSTRSSQFLHERPNQSLVRALFCLLSSP
MRMIVSKFIESYLEWKLPLVKYGLKPDHPFLEDYASCQMAILPQNFFAEADKGKILFKRS
SKXWFWSGGIEFEDNTKLQADVVXLATGYEGKQKLQSILPEPFRSLMVDSSGTMPLYRGT
IHPLIPNMAFVGFVESVSNLQTAELRCKWLGRLVDNKFKLPTVQKMLEQIGREIEVMKKT
TRFYKRHCISTFNINHSDEICEEMGWKSWRKSNWLSEAFSPYNSRDYQEPKHAICTTKWA
KFVLKRQYQLPFKFY
Download sequence
Identical sequences MDP0000215521 MDP0000215521|PACid:22667208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]