SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000218295|PACid:22671514 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000218295|PACid:22671514
Domain Number 1 Region: 39-100
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000149
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000218295|PACid:22671514
Sequence length 138
Sequence
MERWVKSVQKQKAYPLIWILRKRFVDKGIGFWDLWERGGITKGWETKKKMFTSVDCVVVG
GGISGLCIAQVLATKHGDAVPIIIVTEAKDQVGGNIITVWKDGYARAETRLRLERKDLTK
LSHGFGEDKQAGVYRIKS
Download sequence
Identical sequences MDP0000218295 MDP0000218295|PACid:22671514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]