SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000221322|PACid:22644524 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000221322|PACid:22644524
Domain Number 1 Region: 123-237
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000221322|PACid:22644524
Sequence length 803
Sequence
MAGTKATRVGPNPMXRTMKESEKSLDPQLWHACAGGMVHMPPVNSKVFYFPQGHAEHAQS
GGGVDFSAASLRIPSLVLCRVAAIKFMADPETDEVFAKIRMNPIENEAFAAEDGDTEAYG
SENQEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPKLDYSADPPVQTVIAKDVHGEVW
KFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGLDGGGG
NEVASGWNNSHSSGGGSGGCVLPYGSFCVFLREEDNKMRNGGGNLSPNGNMRGKGRVRPE
SVVEAATMAAKGQPFEVVYYPRASTPEFCVXASAVRAAMREQWCSGMRFKMAFETEDSSR
ISWFMGTVSSVQVANPICWPNSPWRLLQTWHCRPYGLKLALWELRTHLVVHILLGHSMNY
LRSVVYLNSVTLLKSCHLIIWLDIDXQTTILQVTWDEPDLLQNVXCVSPWLIELVSNFPM
IHMSPFSPPRKKLRLPQHPDFSLDGQLTLPSFSGNPLGPSSPLCCLPNNTPSGIQGARHA
QFRISLSDLHLNNKLQSGLFSSSFQRFDQSSRISNGIRAGHTSSNENLSCLLTMGNSSQN
SEKPDNVKKHKFLLFGQPILTEQQISRSCSSEAVSQLLPGKNSKDGSQDKTXFFFNGSES
VLGRQVXLEKSTSAGFSWNKDFQATDLDLETGHCKVFMESEDVGRTLDLSALCSYEELYR
RLANMFEIEKPEMMSHVLYRDVTGAVKQTGVEPFSDFMKTAKRLTILTHPASESIGRTWI
RGMQNAENGLGATXKTGPLSIFA
Download sequence
Identical sequences MDP0000221322|PACid:22644524 MDP0000221322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]