SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000224046|PACid:22680307 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000224046|PACid:22680307
Domain Number - Region: 35-82
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0523
Family DNA repair protein MutS, domain III 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000224046|PACid:22680307
Sequence length 95
Sequence
MEVSVATIGAVLVGITVIIIAGAWRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKE
ISTMIKQAYSKPVSLSHDIAPRVIPFDYQLVNTYX
Download sequence
Identical sequences MDP0000224046|PACid:22680307 MDP0000224046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]