SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000225889|PACid:22683127 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000225889|PACid:22683127
Domain Number 1 Region: 628-695
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000275
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000225889|PACid:22683127
Sequence length 696
Sequence
MNSKRKAPMVMGNASNCDNSRERSKLKRKKPDGDIGQDLHGMNATRKAPVVTGNASNCDN
SHERSKLKLKEPDGDIGQHLYVMNAKRKAPVVTGNASNCDNSHERSKFKLKEPDGDIGQD
LYGMNAKTKAPVVTENASNCDNSHERSKLKLKEPDGDIGQHLYVMNAKRKAPVVTGNASN
CDNSHERSKFKLKEPDEDIGQDLYGMNAKTKAPVVTENASNCDNSHXRSKLKLKEPDGVI
DQHLYNMNDKGECTIATENASNYDDSNEMPKLKPKEEYIEDMICMIXRELGDKQEDNRSC
IYDSLNFELLELKSGTETRLARFDKNPVAKEAVAAAFPMDETYSPHDDSSLRLRNEAGSV
DKSPVAKEAVTAAIPMDETCSXHDDSSLRLRGEASLVDKAPVAREAVTIAIPSDAYKFDG
TEKNNSSEARVKKVSPSGDDSRTTNKTSHHLFPTAAVNPNDTGNKVAASKKEHDLIDESF
QRAKKNFTGTPPESFDMMTKAVKKESVDLISDPCFQKIIPEIDGKSFEPVDAVCSQISNM
IKREKDIAFPVPVIKSEPVDQVETFPSSSFSCLVAVGSQSFLNGASDNYTLLIMEMFISK
LIVIMDMPCLIEELPVRLPIRMTIRGRHTPDRRVIFLRDTTMRLWPVLYIDNCFSKILSS
GWEAFSKANNIQPGDTCAIGIEDASERICSVHIIRT
Download sequence
Identical sequences MDP0000225889 MDP0000225889|PACid:22683127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]