SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000225980|PACid:22683343 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000225980|PACid:22683343
Domain Number 1 Region: 156-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.54e-44
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 670-750
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000654
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000225980|PACid:22683343
Sequence length 799
Sequence
MEIDLNHAVSEVEKNAYCNGDCGGVCVXCLSSSTSSSSSNSSSAPVASSIYLELWHACAG
PLISLPKKGNVVVYFPQGHLEQVASSSPFSPMEMPTFDLHPQIFCKVVNVQLLANKENDE
VYTHVTLLPQPEFAGTNLEGKELEELGVDEGDGGSPTKSTPHMFCKTLTASDTSTHGGFS
VPRRAAEDCFPPLDYKQQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFISQK
NLVSGDAVLFLRGENGELRLGIRKAVRPRNCLPDSVVGNQNTYPSVLSLVANAISTKSMF
HVFYSPRASRSEFVIPYQKYVRSIANPVTSGTRFKMRFDRDDSPEKRCSGVVTGIADLDP
FRWPNSKWRCLMVRWDEDIGNDHQDRVSPWEVDPSASLPPMNIQSSPRLKKLRTSLQGTQ
PIHSITAGGAGFKDFEESVKSSKVLQGQENIGFISPLYGCDTVNRSQDFEMHAPAHLSLA
SNATQKATIDELMRARHTSYTGFAESDRFPKVLQGQEICPLRSLTGKANFTLGDWESNIG
CTPFNVYQPPKPNHFSLASESLPNMYFPYGDVHRAXQEPTMCSNATNLPRENMQINPYTV
QMGVTRNEVGRPNKPSEHKTQESTSALPALVPNPRNPNDEDYNGTVTGCKLFGFSLTGEN
PTPNSQSSSKRSCTKVHKQGSLVGXAIDLAKLNGYGDLLTELERLFGMEGLLRDSDEGWR
ILYTDSENDVMVVGDDPWHEFCNVVSKIHIYTQEEVEKMTIGMISDDTQSSLEQAPVMLE
VSKSSSVSQPDSSPTVIRV
Download sequence
Identical sequences MDP0000225980|PACid:22683343 XP_008338388.1.92800 MDP0000225980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]