SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000227080|PACid:22645787 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000227080|PACid:22645787
Domain Number 1 Region: 16-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-23
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 185-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-18
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000227080|PACid:22645787
Sequence length 264
Sequence
MASLIPEMDHRQRPSFSPTTPHFFKIIPVETSRCRKLRIPKKFMNNYGENLSNPVHFKLP
SGAEWEIEVTRRGGKVWFDKGWPKFSEFYSLGYGDCLIFRYEGNSKFHACIFDRSATEIE
YPLPLPGMEETDEDDDESVEILEDFPPCPRTRKKSPLPSPLPHKIKRISTSIGSTTLALQ
RAIDFKSENPHFKVAMQPSYIFNQLILPSEFAKRYLTQHPTGSVILRVPDGRTWNVKFKY
ENKRARFLLDWLAFVEDNNLKIGD
Download sequence
Identical sequences MDP0000227080|PACid:22645787 MDP0000227080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]