SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000229344|PACid:22665895 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000229344|PACid:22665895
Domain Number 1 Region: 365-467
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-21
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000229344|PACid:22665895
Sequence length 937
Sequence
MHVFSPGLTHTDPQKPHSPLITFVNAHCIELAAAASAVAGFGELEFGAMESKICMNPSCR
MANTHEWKTGWPLRSGGFAHLCYKCGVEYENSVYCNTFHSGETGWRDCNLCHKPLHCGCI
VSETLYECLDFGGIGCIGCASQPHVIQDGDVLNGFGGLKISDFGDHQSTVPQNGALSDTA
NEGELLQLCQVMEANESNLSSQSQRGEINVSPVQTKREEVTYPRGEVGPGFSSITRPSFG
SLTFAKPDNGRIMIEVKDMNKXSSEPSLSMTLGGPSATPNFAQPFTGGILERRDQSKMSS
SFQQGQKIRPIFPRPLRPPPPIHNVRVARPPAEGRGKSQLLPRYWPRITDQELQKLAGDL
NSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQSEGLPIRIQDVKGNEWTFQFR
FWPNNNSRMYVLEGVTPCIQSMELQAGDTVTFSRIDPGGRLVIGFRKASRCLDVQESQTS
FLPNGTPGETSCPSVVENLVTGSGHSSIYQMSTGSKDLNALSGHLHLADGDTSLHSNENH
SHFTSEDLQQKPVSNSDKKRARNIGPKSKRLLLHSEDVLELRLTWEEAQDLLRPPLSVKP
SIVTIEDHEFEEYDEPPVFGKRSLFIAESERQEQWARCDDCSKWRRLPVDVLLPPKWTCX
ENSWDINRCSCSAPEEVSQEELDNLLRPSKDLKKRRIVVNHNEAQEHEPSGLDALASASA
AILGDSVDYADEQSVGATTRHPRHRPGCTCIVCIQPPSGKGKHKPTCTCNVCMTVKRRFK
TLMMNKRKRKSEREMENAHXDNNDHKDESEMNGMSTEIELHMNHSSENGSSCEKRIQADV
AESSCAGQIDLNCEPKHNYVQVSGLTLLRLADAVAQQPVKNSTKESGLTNRMCEPQAGLG
SSLRAQDTAETDKLLCNEGSLSSVAAAWDLEGRGDED
Download sequence
Identical sequences MDP0000229344 MDP0000229344|PACid:22665895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]